DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and ppic

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_002931773.2 Gene:ppic / 100494684 XenbaseID:XB-GENE-948735 Length:208 Species:Xenopus tropicalis


Alignment Length:159 Identity:67/159 - (42%)
Similarity:99/159 - (62%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 TNLGPLNLELFCDQTPRACDNFIKHCA--NGY-YNNVMFHRSIRNFIVQGGDPT-GSGSGGESIW 346
            |:.|.:.:.||....|:...||:....  .|| |....|||.|::|::||||.| |.|:||:||:
 Frog    43 TDAGRIVIGLFGKVVPKTVKNFVALATGEKGYGYKGSRFHRVIKDFMIQGGDVTNGDGTGGKSIY 107

  Fly   347 GKKFEDE-FKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKM 410
            |:.|.|| ||  |.|.|.|.:||||:||:||||||||:......|:|||.:|||::.|:..:..:
 Frog   108 GETFPDENFK--LKHYGIGWVSMANAGPDTNGSQFFISTTRPLWLNGKHVVFGKVLEGMAVVHLI 170

  Fly   411 ENIEVDNKDRPIEDIIIESSQVFV--NPF 437
            |..:.:.:|:|::|.:|.:|.|..  .||
 Frog   171 ELQQTNERDQPLKDCVIVNSGVVTVKEPF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 67/159 (42%)
ppicXP_002931773.2 cyclophilin 33..191 CDD:294131 63/149 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.