DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and ppwd1

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_002934239.3 Gene:ppwd1 / 100488042 XenbaseID:XB-GENE-1001509 Length:640 Species:Xenopus tropicalis


Alignment Length:363 Identity:107/363 - (29%)
Similarity:164/363 - (45%) Gaps:92/363 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 QKMDSKSLVKLNFHRNANDEYHCPALFKPFSKNSHIVAVATTGNVYCWEAIDQLNIKTKNWKDLV 148
            :|:|:..|:.:.|     ||            ..|.|...|      ...|..:|::|       
 Frog   345 EKVDAMKLMNIIF-----DE------------TGHFVLYGT------MLGIKVINVET------- 379

  Fly   149 DDTPFQRKDIITIQDPQKLEKYDISTFYHIKKNLRVLTEEEQQERKNPASGRIKTMNLETKETLE 213
                  .:.:..:...:.:....::.|..:.|..|..|..|.:...||              .|.
 Frog   380 ------NRCVRILGKQENIRAMQLAVFQGVAKKHRAATTVEMKASDNP--------------VLL 424

  Fly   214 QLQQD------------------YQPAEEEASTSKRTADKFNAAHYSTGAVAASFTSTAMVPVSQ 260
            .:|.|                  .:|.:.:::.|.|  |.||........:||          :|
 Frog   425 AVQPDPTIVCTAFKKNRFYVFTKREPEDTKSAESDR--DVFNEKPSKEEVMAA----------TQ 477

  Fly   261 IEAAIIDDDLVKYERVKKKGYVRLNTNLGPLNLELFCDQTPRACDNFIKHCANGYYNNVMFHRSI 325
            .|.:         :||.....:  :|::|.::::||..:.|:..:||..|..|||||..||||.|
 Frog   478 AEGS---------KRVSDSAII--HTSMGDIHVKLFPVECPKTVENFCVHSRNGYYNRHMFHRVI 531

  Fly   326 RNFIVQGGDPTGSGSGGESIWGKKFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHL 390
            :.|::|.|||||:|.|||||||.:|||||...|.|.....|||||:||:|||||||:|......|
 Frog   532 KGFMIQTGDPTGTGMGGESIWGGEFEDEFHATLRHDRPYTLSMANAGPSTNGSQFFLTVVPTPWL 596

  Fly   391 DGKHTIFGKLVGGLDTLQKMENIEVDNK-DRPIEDIII 427
            |.|||:||::..|::.:|::.|.:|:.| |:|.|||.|
 Frog   597 DNKHTVFGRVTKGMEVVQRICNSKVNPKTDKPYEDISI 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633 27/171 (16%)
cyclophilin_RING 281..439 CDD:238904 73/148 (49%)
ppwd1XP_002934239.3 WD40 83..312 CDD:421866
WD40 repeat 88..125 CDD:293791
WD40 repeat 131..169 CDD:293791
WD40 repeat 177..213 CDD:293791
WD40 repeat 221..266 CDD:293791
cyclophilin_WD40 489..637 CDD:238908 73/148 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.