DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and Nktr

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_038938667.1 Gene:Nktr / 100364165 RGDID:2321593 Length:1516 Species:Rattus norvegicus


Alignment Length:346 Identity:88/346 - (25%)
Similarity:158/346 - (45%) Gaps:60/346 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LETKETLEQLQQDYQPAEEEASTSKR--TADKFNAAHYSTGAVAASFTSTAMVPVSQIEAAIIDD 268
            :.:::|..|.:..::.|...|.|.:|  :...........|.:.:...|:...||:.:.....|.
  Rat     1 MNSRDTCVQSRVLWRGAPRLALTGRRWCSVGDVRLRRRRQGVLRSCRASSRRRPVAALAMGAQDR 65

  Fly   269 DLVKYERVKKKGYVRLNTN-LGPLNLELFCDQTPRACDNFIKHCANG-----------YYNNVMF 321
            ....::       :.:|.. :|.:..:||.|..|:.|.||:..|:..           .|....|
  Rat    66 PQCHFD-------IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTF 123

  Fly   322 HRSIRNFIVQGGD-PTGSGSGGESIWGKKFEDEFKPN--LTHTGRGVLSMANSGPNTNGSQFFIT 383
            ||.::||::|||| ..|:|.|||||:|..|:||   |  |.|....:|||||.|.:|||||||||
  Rat   124 HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDE---NFILKHDRAFLLSMANRGKHTNGSQFFIT 185

  Fly   384 YRSCKHLDGKHTIFGKLVGGLDTLQKMENIEVDNKDRPIEDIIIESSQVFVNPFAEAAEQLAKER 448
            .:...||||.|.:||.::.|.:.::::||::.|...||..|:.:....|......:  :...|:|
  Rat   186 TKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKLTK--DVFEKKR 248

  Fly   449 EE-----------------EAAGKEEIVKKEEQQKRMKEPLKVYREGVGKYLKLQTVAKKPEAPL 496
            ::                 |::.:.|:.::..:::|.|...||..            .||....:
  Rat   249 KKPTHSEDSDSSSNSSSSSESSSESEVERERIRRRRHKRRPKVRH------------TKKRRKEM 301

  Fly   497 TSAQAAKKKKLAN--GFGDFS 515
            :.::..::|:..:  |:.:.|
  Rat   302 SGSEELRRKRTVSPEGYSERS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633 6/33 (18%)
cyclophilin_RING 281..439 CDD:238904 64/172 (37%)
NktrXP_038938667.1 cyclophilin 66..233 CDD:412213 63/176 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.