DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7747 and cwc27

DIOPT Version :9

Sequence 1:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_002934241.3 Gene:cwc27 / 100145114 XenbaseID:XB-GENE-942796 Length:474 Species:Xenopus tropicalis


Alignment Length:247 Identity:94/247 - (38%)
Similarity:140/247 - (56%) Gaps:26/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 GYVRLNTNLGPLNLELFCDQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGES 344
            |.|.|.|..|.:::||:..:.||||.||::.|..|||:|.:|||.:.:||:|||||||:|:||||
 Frog    13 GKVLLKTTAGEIDIELWSKEAPRACRNFVQLCLEGYYDNTIFHRVVPDFIIQGGDPTGTGTGGES 77

  Fly   345 IWGKKFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQ- 408
            ::||.|.|||...|....||:::|||:||:.||||||.|......|:.||||.||:.|  ||:. 
 Frog    78 VYGKPFRDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRADELNNKHTILGKVTG--DTIYN 140

  Fly   409 --KMENIEVDNKDRPIEDIIIESSQVFVNPFAEAAEQL----AKEREEEAAGKEEIVK------- 460
              ::..:::...:||:....|::::|..|||.:...::    .||:|||...|:...|       
 Frog   141 ILRLAEVDIGEDERPVNPHKIKTTEVLFNPFDDIVPRIIKKSKKEKEEEEEAKKTKAKGTKNFNL 205

  Fly   461 ------KEEQQKRMKEPLKVYREGVGKYLKLQTVAKKPEAPLTSAQAAKKKK 506
                  .||.::.:.|..||.|   || .|......|.:..|:|..|..:.|
 Frog   206 LSFGEEAEEDEEEVNEVSKVMR---GK-SKSSHDLLKDDPGLSSVPAVDRTK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7747NP_611113.1 RING 25..238 CDD:302633
cyclophilin_RING 281..439 CDD:238904 72/160 (45%)
cwc27XP_002934241.3 cyclophilin_CeCYP16-like 8..178 CDD:238906 73/166 (44%)
PTZ00121 <283..>471 CDD:173412
CWC27_CTD 378..430 CDD:412084
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.