DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-26 and CG10560

DIOPT Version :9

Sequence 1:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster


Alignment Length:383 Identity:84/383 - (21%)
Similarity:147/383 - (38%) Gaps:46/383 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WLRYTVLPSILRNGRLVDNYSESKVTTFHVGDIDIDVIGHSEAFMLTFCYRTTINFEYDGQKFQR 74
            |::..|...:|::.  |.:|.::|......|      :...|.: .|...|..::.|...:....
  Fly    20 WVKPEVFEDLLKDN--VKDYKKTKALRAKAG------VAAGENY-ATIMLRLELDVETKDKSEVT 75

  Fly    75 KMVVKKTPAMPPEMYESIQFGPLFTNEINFYTEILPEFQKF-----TDGKFAAPKYYYGELNQHS 134
            |..:.|||.......:.:|...:|..|...|..::||.::.     .:.||.|..|   |:....
  Fly    76 KAFMLKTPHDTDAYRKLLQETNIFDVERGMYLVVVPELEQMYRDVGLEVKFGAEAY---EIKVSE 137

  Fly   135 AVAILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFH-GFAYAMKHKNPEKFAQLTDNLKESRY 198
            ...:||:...:|::......||...|....:....::| ..|..:..|.|          .|.:|
  Fly   138 NYVLLEDLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLKGP----------YEEKY 192

  Fly   199 ANDNIHPEWKLTMKTSIDRAAKAVATYQPQID--EEFVKKFCFMISD--YSQYGRQRVAPREPLA 259
            .|...  :.|..|....||:||.:.....|.|  ..::|.. ..:|:  :..|...:....:...
  Fly   193 TNGFF--KSKEIMNFFCDRSAKILLNNIDQYDGHAAYIKDL-QSVSEKLFDIYNDIKEPKSDEFN 254

  Fly   260 TLCHGDYVRNNVAYRYDDKEEPQEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEVRDPNFEAIFCE 324
            .|.|||...||:.::|:||.|.......|.|..:..|...||..||..|...:::...|:.....
  Fly   255 ALNHGDGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFDYFVWF 319

  Fly   325 YTLALHNSYREHAK-----EEVPDFLSRGELLKEYVRFLPYSLSISASFLMSLVDPLD 377
            |    |:...:|.|     :::|...|....|.:|..: .:..|||...:: |:||.|
  Fly   320 Y----HSELVKHLKLLNYSKKLPTLRSIRNALNKYSGW-AFICSISVMGVV-LLDPTD 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 62/285 (22%)
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 66/301 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.