DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-26 and CG31087

DIOPT Version :9

Sequence 1:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster


Alignment Length:411 Identity:91/411 - (22%)
Similarity:142/411 - (34%) Gaps:111/411 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DNYSESKVTTFHVGDIDIDVIGHSEAFMLTFCYRTTINFEYDGQKFQRKM--VVKKTPAMPPEMY 89
            ||||    |.|....:::::|.||         ...::|....|.....|  ::.|.        
  Fly    53 DNYS----TQFLRLLVEVELIDHS---------TKDLSFVLKAQHSNEMMAAILAKL-------- 96

  Fly    90 ESIQFGPLFTNEINFYTEILPEFQK-FTD-GK---FAAPKYYYGELNQHSAVAILENFAEQGWRV 149
                  .||..|...|..|||:|:| :.| ||   | |||.:..:.:......:||:...:.::.
  Fly    97 ------KLFQKEEQMYHSILPKFEKLYADAGKPIQF-APKAFKFDRDLGVDYILLEDLHRKNFKN 154

  Fly   150 TKDRVGLSLQHAMIAVSYLGRFH-GFAYAMKHKN--PEKFA---------QLTDNLKESRYANDN 202
            .....||.|.|....:..|..|| ..|..::|..  .|:|.         ||......|......
  Fly   155 ANRLAGLDLDHMHKVLEKLAAFHAASACYVEHHGLFGEEFTVGVFSESNRQLLQEFNASGAFLAQ 219

  Fly   203 IHPEWKLTMKTSIDRAAKAVATYQPQIDEEFVKKFCFMISDY--------SQYGRQRVAPREPLA 259
            : .:||...|           .|:...|.:          ||        .||..:.      ..
  Fly   220 L-KKWKNAQK-----------IYEKLADSD----------DYLVDRLLQDQQYNTRE------FN 256

  Fly   260 TLCHGDYVRNNVAYRYDDKEEPQEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEVRDPNFEAIFCE 324
            .|.|||...|||.|::|.....:|.:..|:|..:..||..||...:..|...|::...|:.:...
  Fly   257 VLNHGDCWANNVMYQHDAFGTIKETLFVDFQVGKYGSPANDLYYLILSSAAPELKTAKFDYLVRY 321

  Fly   325 YTLALHNSYREHAKEEVPDFLSRGELLKEYVRFLP---------YSLSISASFLMSLVDP---LD 377
            |.                |.|.....|.:|.|.||         :...::|..::|.|.|   ||
  Fly   322 YF----------------DNLIENLKLLQYHRPLPKLKNLHASLFRNGLAAYMVVSKVLPVVMLD 370

  Fly   378 ISPEEMFALQLSDEEIIERTM 398
            .:.:......:|||..::..|
  Fly   371 KTADANLESYISDESKMKNAM 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 65/302 (22%)
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 77/353 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.