DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-26 and CG10550

DIOPT Version :9

Sequence 1:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:309 Identity:63/309 - (20%)
Similarity:108/309 - (34%) Gaps:48/309 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DGQKFQRKMVVKKTPAMPPEMYESIQFGPLFTNEINFYTEILPEFQKFTDGKFA------APKYY 126
            ||.: ||...:.||........:.|....||..|...|...:|:|.|..  |.|      |||..
  Fly    72 DGSE-QRVSYILKTMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLY--KEAGLEIELAPKCL 133

  Fly   127 YGELNQHSAVAILENFAEQGWRVTKDRV-GLSLQHAMIAVSYLGRFHGFAYAMKHKNPEKFAQLT 190
            :.:........:.|:.:.|.:: ..||: |..|.|....:..|...|..:...|..|....|.. 
  Fly   134 HVDATDELITMVFEDLSRQNFK-NFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMY- 196

  Fly   191 DNLKESRYANDNIHPEWKLTMKTSI-----DRAAKAVATYQPQIDEEFVKKFCFMISDYSQYGRQ 250
                     |.:|:.|....:..|:     ::..||:..:..:..|.::.:....:..:.:..:.
  Fly   197 ---------NMSIYNEQSRDLFESLGKQREEQFLKAMRNWDLENAESYIARMWDPLEVFEEAVQV 252

  Fly   251 RVAPREPLATLCHGDYVRNNVAYRYDDKEEPQEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEVRD 315
            .....:....|.|||...||:.:.|.|..|....::.|.|..:..||..||...:..|...:::.
  Fly   253 NQVDEDEFNVLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKI 317

  Fly   316 PNFEAIFCEYTLALHNSYREHAKEEVPDFLSRGELLKEYVRFLPYSLSI 364
            ..|:.....|          |.:            |.|.::.|.||..|
  Fly   318 KEFDHFIQIY----------HQR------------LAECLKLLNYSKPI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 56/273 (21%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 60/303 (20%)
APH 108..338 CDD:279908 49/264 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.