DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-26 and CG31370

DIOPT Version :9

Sequence 1:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:385 Identity:95/385 - (24%)
Similarity:159/385 - (41%) Gaps:66/385 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QWLRYTVLPSILRNGRLVDNYSESKVTTFHVGDIDI---DVIGHSEAFMLTFCYRTTINFEYDGQ 70
            :||....:..:||        |..|.....|..:|.   ...|.:.|.::   .|..:  ||..|
  Fly    14 EWLNEQFVTDVLR--------SHEKEPDLRVTKLDFTPGSAKGDNYASVI---IRARV--EYITQ 65

  Fly    71 K--FQRKMVVKKTPAMPPEMYESIQFGPLFTNEINFYTEILPEFQKF------TDGKFAAPKYYY 127
            |  |.:.:::|       .:.|......||..||..|.::||||.:.      |...:|...||.
  Fly    66 KGFFSKSLIIK-------TVLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYS 123

  Fly   128 GELNQHSAVAILENFAEQGWRVTKDRVGLSLQHAMI--AVSYLGRFHGFAYAMKHKNPEKFAQLT 190
            .|.:|   |.|.|:..|..:.:.:|||   |.|..|  |.|.|.:||..:..:.::.||...:..
  Fly   124 LEPSQ---VMIFEDLGEMDYAMVRDRV---LTHGEICGAYSKLAKFHALSMKIINERPEFVKEFK 182

  Fly   191 DN--LKESRYANDNIHPEWK--LTMKTSIDRAAKAVATYQPQIDEEFVKKFCFMISDYSQYGRQR 251
            |.  |.:..|.:..:.| :|  |.....:||    ..|:..:|:..|:.:...::.:|      :
  Fly   183 DGICLVDIPYMSSGMGP-FKDFLGRIPELDR----YKTHFEKIEVHFIDRLRDIMKEY------Q 236

  Fly   252 VAPREPLATLCHGDYVRNNVAYRYDDKEEP--QEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEVR 314
            ..|:.....||||||...|:..:: :||..  ::.|:.|||...|:....||...:.:.:..|.|
  Fly   237 TNPQPGYYVLCHGDYHTRNIMVKH-NKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQR 300

  Fly   315 DPNFEAIFCEYTLALHNSYREHAKE-EVPD---FLSRGELLKEY-----VRFLPYSLSIS 365
            ....|.:...|...|..:.|:...: ::||   |......||:|     ..:||.|:.:|
  Fly   301 IGELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 73/291 (25%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 77/306 (25%)
APH <202..320 CDD:279908 29/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.