DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-26 and CG13658

DIOPT Version :9

Sequence 1:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:384 Identity:87/384 - (22%)
Similarity:148/384 - (38%) Gaps:85/384 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WLRYTVLPSILRNGRLVDNYSESKVTTFHVGDIDIDVIGHSEAFMLTFCYRTTINFEYDGQKFQR 74
            ||...::...||        :..|....||.|:.|...........:..:|...::......|.:
  Fly    20 WLNAELIEGALR--------AYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKGNFSK 76

  Fly    75 KMVVKKTPAMPPEMYESIQFGPLFTNEINFYTEILPEFQKF-----TDGKFAAPKYYYGELNQHS 134
            .::||..|.......:.:...|:|..||..|::.|||.::.     ...|..||..|: .|..|.
  Fly    77 ALIVKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYH-SLEPHQ 140

  Fly   135 AVAILENFAEQGWRVTKDRV--GLSLQHAMIAVSYLGRFHGFAYAMKHKNPEKFAQLTDNLKESR 197
             |.|.|:...||:.|.:||.  ...||.|...   |.::|..:..:.::.|       |.|||.:
  Fly   141 -VMIFEDLVPQGYTVIRDRYPNKEELQKAFFK---LAKWHAASMKVLNERP-------DFLKEFK 194

  Fly   198 YA--------NDNIHPEWKLTMKTSIDRAAKAVATYQP---QIDEEFVKKFCFMISDYSQYGRQR 251
            |.        ||:|...........:|:..: :..|:|   :|.:.::::...::.:|      |
  Fly   195 YGLWGMPNFLNDSIVTTGVPCFLEMLDKVPE-LTKYKPYFEKIKDNYIQQMSAVMEEY------R 252

  Fly   252 VAPR-EPLATLCHGDYVRNNVAYRYDDKEEP--QEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEV 313
            ..|: .....|||||:...|:.:|| :||..  :::|:.|:|.    |.:..|::.|..|||.  
  Fly   253 TNPKPNRYYVLCHGDFHGRNMMFRY-NKETGSFEDVMLVDFQI----SNVCPLSIDLIYSIFM-- 310

  Fly   314 RDPNFEAIFCEYTLALHNSYREHAKEEVPDFLSRGELLKEYVRFLPYSLSISASFLMSL 372
                                       |.|...|.:|.|||:.   |..|:.|..|..:
  Fly   311 ---------------------------VMDTEDRWDLGKEYIN---YYFSVLADTLKKI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 67/296 (23%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 78/344 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.