DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-26 and CG6830

DIOPT Version :9

Sequence 1:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:467 Identity:102/467 - (21%)
Similarity:186/467 - (39%) Gaps:86/467 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QWLRYTVLPSILRNGRLVDNYSESKVTTFHVGDIDIDVIGHSEAFMLTFCYRTTINFEYDGQKFQ 73
            :||..|....:|...  ||.:  ||:..|.|.    ..:...|.: .|...|.:|:.|...:..:
  Fly    48 KWLNQTQFEELLAAD--VDQF--SKIVGFRVK----PAMAPGENY-ATLMLRISIDVELTDKSTK 103

  Fly    74 RKMVVKKTPAMPPEMYESIQFGPLFTNEINFYTEILPEFQ-----KFTDGKFAAPKYYYGELNQH 133
            ....:.|.|...|:|.:.:.....||:|...||||||:.:     |..|.|| ||:.:..:..:.
  Fly   104 LVSFMMKVPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKF-APRAFKLDATKE 167

  Fly   134 SAVA---ILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFHGFAYAMKHKN---PEKFAQ-LTD 191
            ..||   ::.:..:.|::.......|:|:....|::.|.:||.....|...:   |:.|.. :..
  Fly   168 PKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDIFVNGVMG 232

  Fly   192 NLKESRYA-NDNIHPEWKLTMKTSIDRAAKAVATYQPQIDEEFVKKFCFMISDYSQYGRQRVAPR 255
            |.||:..| .:.:...::.:...::|:....     .:..|:..|....:..::.:.|  .|.|.
  Fly   233 NNKEAIIAFMEGMLASFRTSFMANLDKFKNG-----EEYREKLEKALAGLTMEFMKLG--IVDPN 290

  Fly   256 EPLATLCHGDYVRNNVAYRYDDKEEPQEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEVRDPNFEA 320
            | ...|.|||...||:.::.:...:.::::..|:|..:..||.:||..|:..|:..:.:..:|:.
  Fly   291 E-FNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFDF 354

  Fly   321 IFCEYTLALHNSYREHAKEEVPDFLSRGELLKE----YVRFLPYSLSISASFL-MSLVDPLDISP 380
            ....|..||    .:|.  .:..|..|...|:|    .:::..:.|..:.|.| :.|:||...:.
  Fly   355 FIRHYQEAL----VKHL--GILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSAT 413

  Fly   381 EEMFALQLSD--------------EEIIERTM----NRGGEVVDREVAHQVKEMLELSQATGVSI 427
            .:.|....:|              :|.|||.:    |||              .||:|       
  Fly   414 FDNFMSDSADGVSFRGSLYANKRCQEYIERILPWLDNRG--------------FLEVS------- 457

  Fly   428 DDGIDLDKLPKE 439
                 .|.||.|
  Fly   458 -----TDPLPPE 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 63/288 (22%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 66/307 (21%)
EcKinase 516..800 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.