DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-26 and CG11889

DIOPT Version :9

Sequence 1:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster


Alignment Length:442 Identity:101/442 - (22%)
Similarity:173/442 - (39%) Gaps:67/442 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LVDNYSESKVTTFHVGD-IDIDVI--------GHSEAFMLTFCYRTTINFEY---DGQKFQRKMV 77
            |.:.|.|.|:..:...| :::..:        |.:.|.::     |.|:.||   |.:..|....
  Fly    13 LTEEYVEKKLRVYFKNDTLNLKKLTIKPATANGENYASVM-----TRISVEYITKDSKDNQSATF 72

  Fly    78 VKKT--PAMPPEMYESIQFGPLFTNEINFYTEILPEFQKFTDGK-------FAAPKYYYGELNQH 133
            :.||  ....|..:..|.:| ::|.||:.|.:|||........:       |||.   .|...:.
  Fly    73 LLKTTFADKDPAAHLLINYG-IYTREIDMYEQILPRLADIVKNELHDSRKLFAAT---VGVDRER 133

  Fly   134 SAVAILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFHGFAYAMKHKNPEKFAQLTDNLKESRY 198
            .:: :.|:.:.:.::|......|.|:|..:.:..|..||....|:..:.|..|        |..|
  Fly   134 DSI-MFEDLSLERYKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIF--------EKNY 189

  Fly   199 AND--NIHPEWKLTMKTSIDRAAKAVATYQPQIDEEFVKKFCFMISDYSQYGRQ--RVAPREPLA 259
            ...  |.|......:..:|.:|........|.:.|.:..|...:|.:...||.:  .|||.: ..
  Fly   190 DRGFFNKHVRGYEPIMKNILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERSTSVAPGD-FV 253

  Fly   260 TLCHGDYVRNNVAYRYDDKEEPQEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEVR-DPNFEAI-- 321
            ||.|||....||.::|||:..|...:..|:|....:||.:||..|.:.||...:| :...|.:  
  Fly   254 TLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQF 318

  Fly   322 -FCEYTLALHNSYREHAKEEVPDFLSRGELLKEYVRFLPYSLSISASFLMSLVDPLDISPEEMFA 385
             |.:..:||.   |.....:||...   |..:::.....|::..|..|            |....
  Fly   319 YFYKLVVALE---RVKYSGKVPSLF---EFQQQFRTKGFYAVFASLIF------------EPTMV 365

  Fly   386 LQLSDEEIIERTMNRGGEVVD-REVAHQVKEMLELSQATGVSIDDGIDLDKL 436
            ....:|..||:.|....:.|. |:..:|.:|.|:....|...:|....||::
  Fly   366 YNGKEEPSIEQFMTSDEKGVRLRDAVYQTEENLKKLHLTLPFLDQLGLLDEM 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 72/295 (24%)
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 76/309 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.