DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-26 and CG9498

DIOPT Version :9

Sequence 1:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster


Alignment Length:422 Identity:97/422 - (22%)
Similarity:160/422 - (37%) Gaps:97/422 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LVDNYSESKVTTFHV--------GDIDIDVIGHSEAFMLTFC---YRTTINFE--YDGQKF---- 72
            |.:...|||||...:        ||              .:|   ||..::|.  .||.:.    
  Fly    25 LEEGLRESKVTLKEINFAWGSNPGD--------------NYCSAIYRVGVSFARWADGGESPVTE 75

  Fly    73 QRKMVVKKTPAMPPEMYESIQFGP---LFTNEINFYTEILPEFQKFTDGKFAAPKYYYGELNQHS 134
            |..::||..|     :.|:.||..   :|..|...||::||.....:.|.....|||:.......
  Fly    76 QLSLIVKTIP-----ITEATQFLEDVCVFIKEKQTYTDVLPRLDILSRGDTFGAKYYHSVKTPVQ 135

  Fly   135 AVAILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFHGFAYAMKHKNPEKFAQLTDNLKESRYA 199
            .: :..:...:|::|.....||...||.:.:..||:||..:..:..|:|....|.|..:...   
  Fly   136 TI-VFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVLAKKDPAIVKQYTRGMLSE--- 196

  Fly   200 NDNIHPEWKLTMKTSIDRAAKAVATYQPQIDEEFVKKFCFMISDYSQYGR-----QRV------- 252
                    .:.||:.         |:: |:...|:|......:.::.|.:     ||:       
  Fly   197 --------DILMKSD---------TFE-QMFGGFLKGLIKSSASWAGYEKISKHLQRLMDNFRNV 243

  Fly   253 ---APR----EPLATLCHGDYVRNNVAYRYDDKEEPQ---EIMMFDYQTLRVSSPMVDLNVFLAV 307
               |||    :....|.|||...||..|.||:..:|.   ..:..|:|.....||..|||.||..
  Fly   244 CADAPRPRKGDRYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNT 308

  Fly   308 SI----FAEVRDPNFEAIFCEYTLALHNSYREHAK-EEVPDFLSRGELLKEYVRFLPYSLSISAS 367
            ||    ..|.|:...:..:..:..||     |:|: |::|.:   .:|..|......|.|....:
  Fly   309 SIKLQLLQERREELIKVYYASFKDAL-----EYARFEDIPSY---EDLQYELRSRETYGLFGMFA 365

  Fly   368 FLMSLVDPLDISPEEMFALQLSDEEIIERTMN 399
            ||..:..|.:::.:.... .:.||...:|.|:
  Fly   366 FLPMITMPKELAQDNSIE-NMQDEAFKQRKMD 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 73/313 (23%)
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 78/337 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.