DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-26 and CG31300

DIOPT Version :9

Sequence 1:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:434 Identity:97/434 - (22%)
Similarity:169/434 - (38%) Gaps:106/434 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKIEAER---------QWLRYTVLPSILRNGRLVDNYSESKVTTFHV------GDIDIDVIGHSE 51
            :|::||:         .||....:..||   ...::..|.||....:      ||       |..
  Fly     3 DKLDAEQFNDDELEAPAWLNRQFIEEIL---SAYEDSPELKVVDLKITPASAQGD-------HYA 57

  Fly    52 AFMLTFCYRTTINFEYDGQKFQRKMVVKKTPAMPPEMYESIQFGPLFTNEINFYTEILPEFQKF- 115
            :.|    :|||........||.|.:::|..|.......:.:....||..||..|.::||||::. 
  Fly    58 SVM----FRTTAECTTAKGKFSRPLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERIL 118

  Fly   116 ----TDGKFAAPKYYYGELNQHS----AVAILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFH 172
                .|.|...|..|      ||    .|.|.|:...||:.|.:|| .::.:....|.:.|.::|
  Fly   119 RESGDDTKLFVPCIY------HSLEPRKVMIFEDLVPQGYYVIRDR-PVAQEELKTAFAKLAKWH 176

  Fly   173 GFAYAMKHKNPEKFAQLTDNLKESRYANDNIHPEWKLTMKTS-------------IDRAAKAVAT 224
              |.:||:     ..:..|.|||.:|....:.     |:||.             :||..: :..
  Fly   177 --AISMKY-----IKEQPDFLKEFKYGLFEMP-----TVKTDPFITTGMQSFIEMLDRLPE-LRK 228

  Fly   225 YQP---QIDEEFVKKFCFMISDYSQYGRQRVAPREPLATLCHGDYVRNNVAYRYDDKEEPQE-IM 285
            |:|   :|.::::::...::.:|.:..:.     :....|||||:...|:.::.:......| .|
  Fly   229 YKPHFEKIKDKYMQRLQAVMKEYHENRKS-----DAFYVLCHGDFHLRNMMFKNNKGTGAHEDTM 288

  Fly   286 MFDYQTLRVSSPMVDLNVFLAVSIFAEVRDPNFEAIFCEYTLALHNSYR---------------- 334
            :.|:|...:....:||...:.:.:..|.|....:.:...|...|..:.:                
  Fly   289 LVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAKLWD 353

  Fly   335 EHAKEEVPDFLSRGELLKEYVRFLPYSLSI-SASFLMS--LVDP 375
            |..|.:..||.    ||.   .|||..|:| |.||.::  :.||
  Fly   354 EIHKNKYYDFF----LLS---TFLPLILAIKSKSFKVNDLIQDP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 67/301 (22%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 71/324 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.