DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-26 and CG1561

DIOPT Version :9

Sequence 1:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster


Alignment Length:274 Identity:66/274 - (24%)
Similarity:121/274 - (44%) Gaps:36/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 QRKMVVKKTPAMPPE-MYESIQF--GPLFTNEINFYTEILP-------EFQKFTDGKFAAPKYYY 127
            :|.:|||    :||: .....||  .|.|..|...|...||       :::...|.:|......:
  Fly   275 KRSLVVK----LPPQNRVRRKQFFARPCFLRETAAYEVFLPLTALIQDKWKIIGDDRFRQHALCF 335

  Fly   128 G-ELNQHSAVAILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFHGFAYAMKHKNPEK---FAQ 188
            | ..::.:...:||:.:..|:.:....:.||::|....:....:.|..:.|.|.:.|||   ..|
  Fly   336 GTRQDEPNECIVLEDLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHAISLAGKRQLPEKMQQLQQ 400

  Fly   189 LTDNLKESRYANDNIHPEWKLTMKTSIDRAAKAVA--TYQPQIDEEFVKKFCF-----MISDYSQ 246
            |.|..::.|  :|:....:...:|.|...|..|.|  .|:.:::..|.:...|     ::|.:: 
  Fly   401 LVDIFEQRR--DDHALGVYFENLKESALSALLAPADDAYRVRLEAYFARGSYFELLLPLVSGFN- 462

  Fly   247 YGRQRVAPREPLATLCHGDYVRNNVAYRYDDKEEPQEIMMFDYQTLRVSSPMVDLNVFLAVSIFA 311
                    .||.|.:||||...||:.|:..::.|.:::.:.|:|.:|.:||:.||..||......
  Fly   463 --------CEPFAVICHGDCWNNNILYKSTERGELEDVRLIDWQLMRYASPVTDLAYFLFTCTSR 519

  Fly   312 EVRDPNFEAIFCEY 325
            ..|..:.|.:..:|
  Fly   520 RFRQRHLENMLEDY 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 66/274 (24%)
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 66/274 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.