DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-26 and E02C12.6

DIOPT Version :9

Sequence 1:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_505426.2 Gene:E02C12.6 / 183987 WormBaseID:WBGene00017092 Length:419 Species:Caenorhabditis elegans


Alignment Length:403 Identity:72/403 - (17%)
Similarity:136/403 - (33%) Gaps:129/403 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KYYYGELNQHSAVAILENF------AEQGWRVTKD--------RVGLSLQHAMIAVSYLGRFHGF 174
            |..:||....|.::.|:.|      .|..|:..:|        .:.:|.|.|::|:|.:..|.| 
 Worm    31 KATFGENKTASNISDLKGFMSRIACVEPDWQNVEDGKKLPVRFALKISSQLALVALSKMLNFGG- 94

  Fly   175 AYAMKHKNPEKFAQLT------------------------------------DNLKESRYAN--D 201
            ......:..:||::||                                    |:||.....:  .
 Worm    95 GNGFTEEKLKKFSKLTRKSHNIEVETYKVLTKFNHPDIPYTKVYSLKPFNGEDDLKGYLITDFIP 159

  Fly   202 NIH--PEWKLTMKTSIDRAAKAVATYQ---PQIDEEFVKKFCFMISDYSQY-------------- 247
            |:|  ..:|.....:|....:.:||:.   ..::.|..|.  ||.:|:.:.              
 Worm   160 NVHVIEAYKSIPADNIAATIRGIATFSALAEHLEREEQKS--FMSTDFLELLFEDFFTDAELSKK 222

  Fly   248 ---------GRQRVAPREPL------------------------ATLCHGDYVRNNVAYRYDDKE 279
                     |:|.......|                        ....|||..::|:.:..|:.:
 Worm   223 FEALKTKFEGQQHAEKVSKLIKVFAHYKALVKKYTNISDLLGLKPVFIHGDLWQSNIMFTLDNSK 287

  Fly   280 EPQEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEVRDPNFEAIFCEYTLALHNSYREHAKEEVPDF 344
            :.:...:.|:|::....|.:||:..:...:.|:.|......:...|    |.:|.:...:|:..|
 Worm   288 KLKLEAIIDWQSVSRIPPGIDLSRIMLGCLSAQERRERGTELLKLY----HETYAKVFGKELFTF 348

  Fly   345 LSRGELLKEYVRFLPYSLSISASFLMSLVDPLDISPEEMFALQLSDEEIIERTMNRGGEVVDREV 409
               .||...|..:.|....:....|.|.:|...||.||..|              ...||..:||
 Worm   349 ---QELQDSYNLYAPMMAMLILPSLSSFLDSAQISKEEKAA--------------AAEEVNLKEV 396

  Fly   410 AHQVKEMLELSQA 422
            | .::::|::.::
 Worm   397 A-MIEDILDIHES 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 50/309 (16%)
E02C12.6NP_505426.2 DUF1679 3..410 CDD:369592 72/403 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.