DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9068 and Dhc36C

DIOPT Version :10

Sequence 1:NP_611111.1 Gene:CG9068 / 36817 FlyBaseID:FBgn0034106 Length:1227 Species:Drosophila melanogaster
Sequence 2:XP_061516090.1 Gene:Dhc36C / 1278929 VectorBaseID:AGAMI1_003215 Length:4021 Species:Anopheles gambiae


Alignment Length:53 Identity:16/53 - (30%)
Similarity:22/53 - (41%) Gaps:9/53 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 IVASNPFD-----DTPPPTPASHMGHMGHPHGGPGHGPGPGMMGHL----GGG 122
            |:..|.|.     |:.|.|.:..||..||......:|...|.:|.:    |||
Mosquito   177 IIEGNNFAYDVRLDSVPFTVSLFMGDGGHTKLLVLYGTKTGRLGLVSVPQGGG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9068NP_611111.1 DHC_N1 212..784 CDD:462457
Dhc36CXP_061516090.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.