DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9068 and Dnah12

DIOPT Version :10

Sequence 1:NP_611111.1 Gene:CG9068 / 36817 FlyBaseID:FBgn0034106 Length:1227 Species:Drosophila melanogaster
Sequence 2:NP_001357813.1 Gene:Dnah12 / 110083 MGIID:107720 Length:3960 Species:Mus musculus


Alignment Length:44 Identity:13/44 - (29%)
Similarity:18/44 - (40%) Gaps:10/44 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   819 IYPCGG----CHKEVHD-NDQG---ILC--ESGCNFWFHRTCSG 852
            |||...    .|:|:.. .|:|   :||  .|.....:.|.|.|
Mouse    79 IYPLPSHRSIKHRELRSILDRGSPMLLCAVASDSTLVYQRLCDG 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9068NP_611111.1 DHC_N1 212..784 CDD:462457
Dnah12NP_001357813.1 DHC_N2 676..1110 CDD:462462
DYN1 891..3595 CDD:227570
AAA_6 1238..1564 CDD:463697
AAA_8 2246..2506 CDD:463701
AAA_9 2894..3115 CDD:463702
Dynein_C 3655..3956 CDD:465677
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.