DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7755 and IDH-IV

DIOPT Version :9

Sequence 1:NP_611110.2 Gene:CG7755 / 36816 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_174526.2 Gene:IDH-IV / 840142 AraportID:AT1G32480 Length:214 Species:Arabidopsis thaliana


Alignment Length:215 Identity:52/215 - (24%)
Similarity:96/215 - (44%) Gaps:18/215 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TIIGQQGAQFVSSLLSSSRVPV--EVQVIEAGQDD----EYFHSVLRNRTAVH--VDNQADAEAK 119
            |:|.......|..::.:.:.||  |..:|:....:    |...|:.:|:..::  |:|.....|:
plant     6 TVIDSNVTNAVHQVMDAMQAPVYFETYIIKGKNMNHLTWEVVDSIRKNKVCLNGRVNNSLCGGAR 70

  Fly   120 QKALKICNDLDLYVFKTRTRSFPGFKCRFPGVDIQLIGQNNMGIFNELEYSPVEGVVEALSVVSQ 184
            :       :|||:.......:..|...|...|||.:|.:|..|.:...|:..|.||:|:..|...
plant    71 K-------ELDLFASLVDCFNLNGQPSRHENVDIVVIRENTEGEYAGREHEVVPGVIESFQVTMT 128

  Fly   185 K-GNDKYLRYAFKAAAKAGRKRVTLI-NKAKEWPISDGSLVEAAQRLHCHYKDCLELELMEVEEA 247
            | .:|:..:|||:.|..:.||:||.: |..|...::|...:|:.|.:...|.:....|: .:...
plant   129 KFWSDRIAKYAFEYAHFSKRKKVTAVHNNGKYEKLADAFFLESCQEVAKMYPNITYNEI-GINNC 192

  Fly   248 ISRLMTEPTYFDCLFASERY 267
            ..:|:.:|..||.:.....|
plant   193 CLQLVEKPERFDVIVTPNLY 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 52/215 (24%)
IDH-IVNP_174526.2 Iso_dh 2..>213 CDD:294303 52/215 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11835
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.