DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7755 and idh3a

DIOPT Version :9

Sequence 1:NP_611110.2 Gene:CG7755 / 36816 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_989352.1 Gene:idh3a / 394979 XenbaseID:XB-GENE-943186 Length:366 Species:Xenopus tropicalis


Alignment Length:369 Identity:81/369 - (21%)
Similarity:160/369 - (43%) Gaps:60/369 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LPKSKYGG------INTVSLVTGTTIIGQQGAQFVSSLLSSSRVPVEVQVIEAGQDDEYFHSVLR 103
            |...:||.      :.||:|:.|.. ||.:.:..|..:..:::.||:.:.              |
 Frog    17 LTAPEYGARQLSNHVQTVTLIPGDG-IGPEISTAVMKIFETAKAPVQWEE--------------R 66

  Fly   104 NRTAVHVDN---QADAEAKQKA-----------------------LKICNDLDLYVFKTRTRSFP 142
            |.||:....   ....|||:..                       |.:....|||.......|..
 Frog    67 NVTAIKGPGGKWMIPPEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIE 131

  Fly   143 GFKCRFPGVDIQLIGQNNMGIFNELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVT 207
            |::..:..||:..|.:|..|.::.:|:..|:|||:::.:::::.:.:..::||:.|....|..||
 Frog   132 GYRTPYTDVDLVTIRENTEGEYSGIEHVIVDGVVQSIKLITEEASHRIAQFAFEYARNNQRSTVT 196

  Fly   208 LINKAKEWPISDGSLVEAAQRLHCHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLS 272
            .::||....:|||..::..:.:..::|| ::...|.::.....::.:||.||.|.....|...||
 Frog   197 AVHKANIMRMSDGLFLKKCREVAENFKD-IKFNEMYLDTVCLNMVQDPTQFDVLVMPNLYGDILS 260

  Fly   273 AICSGVCGGANLFSAVEIGDHH-AVFKPLQ---TKLSLTNYANLSAYGIVSTIVDLFQHLGHDKC 333
            .:|:|:.||..:..:..||.:. |:|:.:.   ..::..:.||.:|  ::.:.|.:.:|:|..:.
 Frog   261 DLCAGLIGGLGVTPSGNIGANGVAIFESVHGTAPDIAGKDLANPTA--LLLSAVMMLRHMGLHEH 323

  Fly   334 ADALWCELKRTMDEG-IRTKEFGGQDTGEYVICNIINQLRCRAL 376
            |..:......|:..| ..||:.||...     |:......||.:
 Frog   324 ARKIENACFETIKSGKALTKDLGGNSK-----CSEFTNEICRRI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 77/356 (22%)
idh3aNP_989352.1 mito_nad_idh 31..362 CDD:272942 78/353 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.