DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7755 and IDH3B

DIOPT Version :9

Sequence 1:NP_611110.2 Gene:CG7755 / 36816 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001317692.1 Gene:IDH3B / 3420 HGNCID:5385 Length:387 Species:Homo sapiens


Alignment Length:364 Identity:85/364 - (23%)
Similarity:166/364 - (45%) Gaps:30/364 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AAYAKGDARADPVNVLPKSKYGGINTVSLVTGTTIIGQQGAQFVSSLLSSSRVPVEVQ-----VI 89
            ||:|...::|:.|.|      .|...|:::.|.. :|.:....|..:..::.||||.|     .:
Human    31 AAHAASRSQAEDVRV------EGSFPVTMLPGDG-VGPELMHAVKEVFKAAAVPVEFQEHHLSEV 88

  Fly    90 EAGQDDEYFHSVL----RNRTA----VHVDNQADAEAKQKALKICNDLDLYVFKTRTRSFPGFKC 146
            :....:|....||    .|:.|    :|...:...|.....:::...|||:......:|.||:..
Human    89 QNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMT 153

  Fly   147 RFPGVDIQLIGQNNMGIFNELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVTLINK 211
            |...:|:.:|.:...|.::.||:....||:|.|.:|::..:.:..::||..|.|.||.:||.::|
Human   154 RHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHK 218

  Fly   212 AKEWPISDGSLVEAAQRLHCHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLSAICS 276
            |....:.||..::..:.:...|.. ::.|.|.::....:|:..|..||.|.....|...:..:.:
Human   219 ANIMKLGDGLFLQCCEEVAELYPK-IKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAA 282

  Fly   277 GVCGGANLFSAVEIGDHHAVFK-----PLQTKLSLTNYANLSAYGIVSTIVDLFQHLGHDKCADA 336
            |:.|||.:.........:|||:     |....:. .|.||.:|  ::.:..::.:||..:..:..
Human   283 GLVGGAGVVPGESYSAEYAVFETGARHPFAQAVG-RNIANPTA--MLLSASNMLRHLNLEYHSSM 344

  Fly   337 LWCELKRTMDEG-IRTKEFGGQDTGEYVICNIINQLRCR 374
            :...:|:.:..| :||::.||..|....|.::|..|:.:
Human   345 IADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 78/338 (23%)
IDH3BNP_001317692.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.