DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7755 and IDH3A

DIOPT Version :9

Sequence 1:NP_611110.2 Gene:CG7755 / 36816 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_005521.1 Gene:IDH3A / 3419 HGNCID:5384 Length:366 Species:Homo sapiens


Alignment Length:355 Identity:79/355 - (22%)
Similarity:155/355 - (43%) Gaps:54/355 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GGINTVSLVTGTTIIGQQGAQFVSSLLSSSRVPVEVQVIEAGQDDEYFHSVLRNRTAVHVDN--- 112
            ||:.||:|:.|.. ||.:.:..|..:..:::.|::.:.              ||.||:....   
Human    29 GGVQTVTLIPGDG-IGPEISAAVMKIFDAAKAPIQWEE--------------RNVTAIQGPGGKW 78

  Fly   113 QADAEAKQKA-----------------------LKICNDLDLYVFKTRTRSFPGFKCRFPGVDIQ 154
            ...:|||:..                       |.:....|||.......|..|:|..:..|:|.
Human    79 MIPSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIV 143

  Fly   155 LIGQNNMGIFNELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVTLINKAKEWPISD 219
            .|.:|..|.::.:|:..|:|||:::.::::..:.:...:||:.|....|..||.::||....:||
Human   144 TIRENTEGEYSGIEHVIVDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHKANIMRMSD 208

  Fly   220 GSLVEAAQRLHCHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLSAICSGVCGGANL 284
            |..::..:.:....|| ::...|.::.....::.:|:.||.|.....|...||.:|:|:.||..:
Human   209 GLFLQKCREVAESCKD-IKFNEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLIGGLGV 272

  Fly   285 FSAVEIGDHH-AVFKPLQ---TKLSLTNYANLSAYGIVSTIVDLFQHLGHDKCADALWCELKRTM 345
            ..:..||.:. |:|:.:.   ..::..:.||.:|  ::.:.|.:.:|:|....|..:......|:
Human   273 TPSGNIGANGVAIFESVHGTAPDIAGKDMANPTA--LLLSAVMMLRHMGLFDHAARIEAACFATI 335

  Fly   346 DEG-IRTKEFGGQDTGEYVICNIINQLRCR 374
            .:| ..||:.||.     ..|:...:..||
Human   336 KDGKSLTKDLGGN-----AKCSDFTEEICR 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 77/350 (22%)
IDH3ANP_005521.1 mito_nad_idh 29..362 CDD:272942 79/355 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S361
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.