DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7755 and idh1

DIOPT Version :9

Sequence 1:NP_611110.2 Gene:CG7755 / 36816 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_594397.1 Gene:idh1 / 2541894 PomBaseID:SPAC11G7.03 Length:356 Species:Schizosaccharomyces pombe


Alignment Length:346 Identity:88/346 - (25%)
Similarity:157/346 - (45%) Gaps:48/346 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KYGGINTVSLVTGTTIIGQQGAQFVSSLLSSSRVPVEVQVIEAGQDDEYFHSVLRNRTAVHVDNQ 113
            ||||..||:|:.|.. ||::.:..|:.:..::.||:|.:.|:.              |.:..:|:
pombe    16 KYGGKYTVTLIPGDG-IGRETSNAVTEIFKTANVPIEFEEIDV--------------TGMEKNNK 65

  Fly   114 ADAEAKQKALK----------------------------ICNDLDLYVFKTRTRSFPGFKCRFPG 150
            :..:|..:|::                            :..:||:|......::.||||.|...
pombe    66 SSGDALHEAIQSLKRNKVGLKGILFTPFEKGGHTSFNVALRKELDIYASLVLIKNIPGFKTRHDN 130

  Fly   151 VDIQLIGQNNMGIFNELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVTLINKAKEW 215
            ||..:|.:|..|.::.||:..|.||||:|.::::..:.:..::||..|.:.|||.||.|:||...
pombe   131 VDFAIIRENTEGEYSGLEHQSVPGVVESLKIITEYKSKRIAQFAFDFALQNGRKSVTCIHKANIM 195

  Fly   216 PISDGSLVEAAQRLHCHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLSAICSGVCG 280
            .::||........:...| |.:..:.:.|:.|..:.::.|..||.|.....|.:.||.|.|.:.|
pombe   196 KLADGLFRRTFYDVANGY-DAITPKDLIVDNASMQAVSRPQQFDVLVMPNLYGSILSNIGSALVG 259

  Fly   281 GANLFSAVEIGDHHAVFKP--LQTKLSLTNYANLSAYGIVSTIVDLFQHLGHDKCADALWCELKR 343
            |..:......|..:|:|:|  ....||:|.....:....:.:...:.:|||....||.:......
pombe   260 GPGVIPGANFGRDYALFEPGCRHVGLSITGRGEANPTAAILSACLMLRHLGLKDYADLINAATYS 324

  Fly   344 TMDEG-IRTKEFGGQ-DTGEY 362
            .::|| ..||:.||. .||::
pombe   325 VIEEGKTLTKDLGGSASTGDF 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 86/344 (25%)
idh1NP_594397.1 mito_nad_idh 18..353 CDD:272942 86/344 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11835
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.