DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7755 and Idh3b

DIOPT Version :9

Sequence 1:NP_611110.2 Gene:CG7755 / 36816 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_570954.1 Gene:Idh3b / 170718 MGIID:2158650 Length:384 Species:Mus musculus


Alignment Length:360 Identity:84/360 - (23%)
Similarity:166/360 - (46%) Gaps:30/360 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AYAKGDARADPVNVLPKSKYGGINTVSLVTGTTIIGQQGAQFVSSLLSSSRVPV--------EVQ 87
            |:|...::|..|.|      .|...|:::.|.. :|.:....|..:..::.|||        |||
Mouse    31 AHAASQSQAQDVRV------EGAFPVTMLPGDG-VGPELMHAVKEVFKAAAVPVEFKEHHLSEVQ 88

  Fly    88 VIEAGQD-DEYFHSVLRNRTA----VHVDNQADAEAKQKALKICNDLDLYVFKTRTRSFPGFKCR 147
            .:.:.:. ::...|:..|:.|    ::...:...|.....:::...|||:......:|.||:|.|
Mouse    89 NMASEEKLEQVLSSMKENKVAIIGKIYTPMEYKGELASYDMQLRRKLDLFANVVHVKSLPGYKTR 153

  Fly   148 FPGVDIQLIGQNNMGIFNELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVTLINKA 212
            ...:|:.:|.:...|.::.||:...:||:|.|.:|::..:.:..::||..|.|.||.:||.::||
Mouse   154 HNNLDLVIIREQTEGEYSSLEHESAKGVIECLKIVTRTKSQRIAKFAFDYATKKGRSKVTAVHKA 218

  Fly   213 KEWPISDGSLVEAAQRLHCHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLSAICSG 277
            ....:.||..::..:.:...|.. ::.|.|.::....:|:..|..||.|.....|...:..:.:|
Mouse   219 NIMKLGDGLFLQCCEEVAELYPK-IKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAG 282

  Fly   278 VCGGANLFSAVEIGDHHAVFK-----PLQTKLSLTNYANLSAYGIVSTIVDLFQHLGHDKCADAL 337
            :.|||.:.........:|||:     |....:. .|.||.:|..:.:|  ::.:||..:..:..:
Mouse   283 LVGGAGVVPGESYSAEYAVFETGARHPFAQAVG-RNIANPTAMLLSAT--NMLRHLNLEYHSSMI 344

  Fly   338 WCELKRTMDEG-IRTKEFGGQDTGEYVICNIINQL 371
            ...:|:.:..| :||::.||..|....|.::|..|
Mouse   345 ADAVKKVIKAGKVRTRDMGGYSTTTDFIKSVIGHL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 78/338 (23%)
Idh3bNP_570954.1 Iso_dh 46..379 CDD:351095 78/337 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.