DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and NEUROD4

DIOPT Version :9

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_067014.2 Gene:NEUROD4 / 58158 HGNCID:13802 Length:331 Species:Homo sapiens


Alignment Length:138 Identity:47/138 - (34%)
Similarity:72/138 - (52%) Gaps:26/138 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SPEWQFLDAAGGTQTELGPIMEAQGQHTQPQTKRRSNSFT---------------GSDGRKSSPE 92
            :|.|  :|...|:|.|:      :.:.::|.|....:|.|               |...::..|:
Human    17 TPSW--MDKGLGSQNEV------KEEESRPGTYGMLSSLTEEHDSIEEEEEEEEDGEKPKRRGPK 73

  Fly    93 QTNLSPTVQKR---RRQAANARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILA 154
            :..::....:|   ||..||||||.||:|||.|.:.||.|:|..|..|||||.|||::|::||.|
Human    74 KKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWA 138

  Fly   155 LCDLLNNG 162
            |.::|..|
Human   139 LSEVLETG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 HLH 104..155 CDD:278439 30/50 (60%)
NEUROD4NP_067014.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..80 12/70 (17%)
HLH 88..144 CDD:238036 32/55 (58%)
Neuro_bHLH 146..264 CDD:289310 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..265
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.