DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and Ascl3

DIOPT Version :10

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_064435.1 Gene:Ascl3 / 56787 MGIID:1928820 Length:174 Species:Mus musculus


Alignment Length:60 Identity:24/60 - (40%)
Similarity:36/60 - (60%) Gaps:5/60 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VQKRRRQAANARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILALCDLL 159
            ::||     |.|||:|:..:|..:.|||..:|...::::|||.|||:.|..||..|..||
Mouse    94 IRKR-----NERERQRVKCVNEGYARLRRHLPEDYLEKRLSKVETLRAAIKYISYLQSLL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 bHLH_TS_ATOH1_like 104..159 CDD:381436 20/54 (37%)
Ascl3NP_064435.1 bHLH_TS_ASCL3 90..148 CDD:381588 22/58 (38%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 92..105 6/15 (40%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 106..144 14/37 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..174
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.