DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and atoh1b

DIOPT Version :9

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001122151.1 Gene:atoh1b / 493915 ZFINID:ZDB-GENE-041201-1 Length:206 Species:Danio rerio


Alignment Length:154 Identity:55/154 - (35%)
Similarity:79/154 - (51%) Gaps:34/154 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QDYGQGAFLSPEWQFLDAAGGTQTELGPIMEAQGQHTQPQTKRRSNSFTGSDGRKSSPEQTNLSP 98
            ::|.:.|..||..:::.:         |...::..|.      .|.:..||....|.|       
Zfish    48 ENYARTAADSPMEKYISS---------PQAASEDHHA------GSKARPGSKASVSGP------- 90

  Fly    99 TVQKRRRQAANARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILALCDLLNNGD 163
              |:.||.|||||||:||:|||.||::||.|:|:...::||||::||||||.||..|.:|| .|.
Zfish    91 --QRHRRVAANARERRRMHGLNRAFDKLRSVIPSLENEKKLSKYDTLQMAQIYITELSELL-EGV 152

  Fly   164 VEVDAAA-------YTIFGDSDSG 180
            |:..|..       |.|  |:.||
Zfish   153 VQSGAPGSQRTAIPYAI--DATSG 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 HLH 104..155 CDD:278439 32/50 (64%)
atoh1bNP_001122151.1 HLH 92..150 CDD:238036 35/58 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26616
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.