DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and NEUROD1

DIOPT Version :9

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_002491.3 Gene:NEUROD1 / 4760 HGNCID:7762 Length:356 Species:Homo sapiens


Alignment Length:97 Identity:42/97 - (43%)
Similarity:54/97 - (55%) Gaps:20/97 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QGQHTQPQTKRRSNSFTGSDGRKSSPEQTNLSPTVQKRRRQAANARERKRMNGLNAAFERLREVV 130
            :|...:..||.|...|                    |.||..||||||.||:|||||.:.||:||
Human    84 RGPKKKKMTKARLERF--------------------KLRRMKANARERNRMHGLNAALDNLRKVV 128

  Fly   131 PAPSIDQKLSKFETLQMAQSYILALCDLLNNG 162
            |..|..|||||.|||::|::||.||.::|.:|
Human   129 PCYSKTQKLSKIETLRLAKNYIWALSEILRSG 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 HLH 104..155 CDD:278439 32/50 (64%)
NEUROD1NP_002491.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94 2/9 (22%)
bHLH_TS_NeuroD1 75..160 CDD:381562 41/95 (43%)
Nuclear localization signal. /evidence=ECO:0000255 87..93 0/5 (0%)
Neuro_bHLH 160..284 CDD:403655 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5207
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.