DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and Fer3

DIOPT Version :9

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:145 Identity:46/145 - (31%)
Similarity:75/145 - (51%) Gaps:22/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TQLPPVSGQD-YGQGAFLSPEWQFLDAAGG---------TQTELGPIMEAQGQHTQPQTKRRSNS 80
            |.:|.|..|. :||.|...|...:.:...|         .::::.|::.     .:|.|..|:| 
  Fly    11 TYMPDVPFQPLWGQEAPPPPIVPYQELIAGFPCTDLSLWQRSQVTPLVP-----QRPSTNGRAN- 69

  Fly    81 FTGSDGRKSSPEQTNLSPTVQKRRRQAANARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETL 145
                 |..||.::|........:|| |||.|||:||..||.||::||..||..:.:::||:.|||
  Fly    70 -----GSSSSSKKTRRRVASMAQRR-AANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETL 128

  Fly   146 QMAQSYILALCDLLN 160
            ::|.:||..:.:||:
  Fly   129 RLAITYIGFMAELLS 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 HLH 104..155 CDD:278439 26/50 (52%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 24/48 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.