DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and tap

DIOPT Version :9

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster


Alignment Length:187 Identity:53/187 - (28%)
Similarity:76/187 - (40%) Gaps:46/187 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PVSGQDYGQGAFLSPEWQF---LDAAGGTQTELG-----------------------PIMEAQGQ 68
            |.||..:......||...|   ||.:....|..|                       |:...:..
  Fly    59 PYSGGTWDAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKSPEDP 123

  Fly    69 HTQPQTKRR----SNSFTGSDGRKSSPEQTNLSPTVQKRRRQAANARERKRMNGLNAAFERLREV 129
            :. |:.||:    .|..|    |..||.|.   ..:::.||..||.|||.||:.||.|.|:||..
  Fly   124 NA-PRPKRKYAVGKNRVT----RSRSPTQV---VKIKRFRRMKANDRERNRMHNLNDALEKLRVT 180

  Fly   130 VPAPSIDQKLSKFETLQMAQSYILALCDLL-NNGDVEVDAAAYTIFGDSDSGFGLSG 185
            :|:...:.||:|.|.|:.|.:||.||..:| :.|.:.:|.       :....|.|||
  Fly   181 LPSLPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDL-------EKLQNFTLSG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 HLH 104..155 CDD:278439 24/50 (48%)
tapNP_524124.1 HLH 155..207 CDD:278439 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.