DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and Atoh7

DIOPT Version :9

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001163953.1 Gene:Atoh7 / 365564 RGDID:1304957 Length:149 Species:Rattus norvegicus


Alignment Length:100 Identity:50/100 - (50%)
Similarity:58/100 - (57%) Gaps:11/100 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GPIMEAQGQHTQPQTKRRSNSFTGSDGRKSSPEQTNLSPTVQKRRRQAANARERKRMNGLNAAFE 124
            ||...|:|.........|:.|..| .||..|          ..|||.|||||||:||.|||.||:
  Rat     9 GPPAGARGAPPCAGAAERAVSCAG-PGRLES----------AARRRLAANARERRRMQGLNTAFD 62

  Fly   125 RLREVVPAPSIDQKLSKFETLQMAQSYILALCDLL 159
            |||.|||....|:||||:||||||.|||:||..:|
  Rat    63 RLRRVVPQWGQDKKLSKYETLQMALSYIVALTRIL 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 HLH 104..155 CDD:278439 36/50 (72%)
Atoh7NP_001163953.1 HLH 54..99 CDD:197674 28/43 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003687
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.