DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and amos

DIOPT Version :9

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster


Alignment Length:174 Identity:62/174 - (35%)
Similarity:86/174 - (49%) Gaps:36/174 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSSASEEDGSS-----QYLGSPNYNLTQLPPVSGQDYGQGAFLSPEWQFLDAAGGTQTEL--GP 61
            :.:|.|:.||::     .|..:|                  :.|..| ..|:|....|..|  .|
  Fly    41 FSTSDSQSDGANSCSLEMYYDTP------------------SVLELE-HMLNAQEQQQHHLQANP 86

  Fly    62 IMEAQG---------QHTQPQTK-RRSNSFTGSDGRKSSPEQTNLSPTVQKRRRQAANARERKRM 116
            :.:.||         |.::|..| ..|.|.:.|....||.........|.|:||.|||||||:||
  Fly    87 LGKNQGRSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRRM 151

  Fly   117 NGLNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILALCDLLN 160
            |.||.||::||:|||:...|::|||:|||||||:||..|..||:
  Fly   152 NSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLLS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 HLH 104..155 CDD:278439 34/50 (68%)
amosNP_477446.1 HLH 137..195 CDD:238036 37/57 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I6373
eggNOG 1 0.900 - - E1_KOG4395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003687
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.