| Sequence 1: | NP_477344.1 | Gene: | cato / 36813 | FlyBaseID: | FBgn0024249 | Length: | 189 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001004311.2 | Gene: | FIGLA / 344018 | HGNCID: | 24669 | Length: | 219 | Species: | Homo sapiens |
| Alignment Length: | 74 | Identity: | 32/74 - (43%) |
|---|---|---|---|
| Similarity: | 43/74 - (58%) | Gaps: | 4/74 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 86 GRKSSPEQTNLSPTVQKRRRQAANARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQS 150
Fly 151 YILALCDLL 159 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| cato | NP_477344.1 | bHLH_TS_ATOH1_like | 104..159 | CDD:381436 | 23/54 (43%) |
| FIGLA | NP_001004311.2 | bHLH_TS_FIGLA | 67..122 | CDD:381428 | 26/57 (46%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 124..151 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||