DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and Lyl1

DIOPT Version :10

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001007678.1 Gene:Lyl1 / 304663 RGDID:1359244 Length:278 Species:Rattus norvegicus


Alignment Length:77 Identity:32/77 - (41%)
Similarity:40/77 - (51%) Gaps:6/77 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 RRQAANARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILALCDLLNNGDVEVDA 168
            ||...|:|||.|...:|.||..||:::|....|:||||.|.|::|..||..|..||.      |.
  Rat   150 RRVFTNSRERWRQQHVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLR------DQ 208

  Fly   169 AAYTIFGDSDSG 180
            ||....|.|..|
  Rat   209 AAVLASGPSAPG 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 bHLH_TS_ATOH1_like 104..159 CDD:381436 24/54 (44%)
Lyl1NP_001007678.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
bHLH_TS_LYL1 145..209 CDD:381548 27/64 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..278 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.