DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and atoh1a

DIOPT Version :9

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_571166.2 Gene:atoh1a / 30303 ZFINID:ZDB-GENE-990415-17 Length:292 Species:Danio rerio


Alignment Length:143 Identity:61/143 - (42%)
Similarity:80/143 - (55%) Gaps:18/143 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AFLSPEWQFLDAAGGTQTELGPIMEAQGQHTQPQTKRRSNS------------FTGSD-GRKSSP 91
            |:|:|......||........|...|:|..:....::.|.|            ..|:| ||:.:|
Zfish    43 AWLAPVQAGTCAAHAEYLLHSPGSSAEGVSSASNFRKSSKSPVKVRELCRLKGAVGADEGRQRAP 107

  Fly    92 --EQTNLSPTVQKRRRQAANARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILA 154
              :.||:   |||:||.|||||||:||:|||.||:.||.|:||...|:||||:|||||||.||.|
Zfish   108 SSKSTNV---VQKQRRMAANARERRRMHGLNHAFDELRSVIPAFDNDKKLSKYETLQMAQIYINA 169

  Fly   155 LCDLLNNGDVEVD 167
            |.|||.....:.|
Zfish   170 LSDLLQGPGAKAD 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 HLH 104..155 CDD:278439 35/50 (70%)
atoh1aNP_571166.2 HLH 117..175 CDD:238036 40/57 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26616
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 1 1.000 - - X4691
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.