DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and neurod4

DIOPT Version :9

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_739568.2 Gene:neurod4 / 266958 ZFINID:ZDB-GENE-030730-1 Length:348 Species:Danio rerio


Alignment Length:110 Identity:44/110 - (40%)
Similarity:65/110 - (59%) Gaps:8/110 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GPIMEAQGQHTQPQTKRRSNSFTGSDGRKS----SPEQTNLSPTVQKR---RRQAANARERKRMN 117
            || :|...:....:.:...:...|.||.|:    .|::..::...|:|   ||..||||||.||:
Zfish    48 GP-LEIGSEDMDEEEEEEEDEEMGLDGEKAPKRRGPKKKKMTKARQERFRARRIKANARERSRMH 111

  Fly   118 GLNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILALCDLLNNG 162
            |||.|.:.||.|:|..|..|||||.|||::|::||.||.::|.:|
Zfish   112 GLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVLESG 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 HLH 104..155 CDD:278439 30/50 (60%)
neurod4NP_739568.2 HLH 98..154 CDD:238036 32/55 (58%)
Neuro_bHLH 156..272 CDD:289310 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.