DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and Bhlha15

DIOPT Version :9

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_034930.1 Gene:Bhlha15 / 17341 MGIID:891976 Length:197 Species:Mus musculus


Alignment Length:107 Identity:40/107 - (37%)
Similarity:58/107 - (54%) Gaps:18/107 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AGGTQTELG---PIMEAQGQHTQPQTKRRSNSFTGSDGRKSSPEQTNLSPTVQKRRRQAANARER 113
            :||::...|   ....|.|...:...:|:     ||.||:.:..|          ||..:|.|||
Mouse    33 SGGSELTKGLRSRTARASGGRGEVSRRRQ-----GSGGRRENSVQ----------RRLESNERER 82

  Fly   114 KRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILAL 155
            :||:.||.||:.||||:|....|:||||.|||.:|::||.:|
Mouse    83 QRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 HLH 104..155 CDD:278439 28/50 (56%)
Bhlha15NP_034930.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 15/63 (24%)
HLH 70..124 CDD:238036 29/63 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..197
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5389
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.