DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and Ascl2

DIOPT Version :10

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_032580.2 Gene:Ascl2 / 17173 MGIID:96920 Length:263 Species:Mus musculus


Alignment Length:148 Identity:48/148 - (32%)
Similarity:64/148 - (43%) Gaps:41/148 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AQGQHTQ-------PQTKRRSNSFTGSDG---RKSSPEQTNLSPTVQKRRRQAA----------- 108
            |||.:..       |:....|:...|:..   |::|||....|    :|||..|           
Mouse    61 AQGLNASLMDGGALPRLMPTSSGVAGACAARRRQASPELLRCS----RRRRSGATEASSSSAAVA 121

  Fly   109 --NARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILALCDLLNNGDVEVDAAAY 171
              |.|||.|:..:|..|:.||:.||....::||||.|||:.|..||.||..||...|. |.||  
Mouse   122 RRNERERNRVKLVNLGFQALRQHVPHGGANKKLSKVETLRSAVEYIRALQRLLAEHDA-VRAA-- 183

  Fly   172 TIFGDSDSGFGLSGGSLS 189
                       |:||.|:
Mouse   184 -----------LAGGLLT 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 bHLH_TS_ATOH1_like 104..159 CDD:381436 26/67 (39%)
Ascl2NP_032580.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..126 5/21 (24%)
bHLH_TS_ASCL2_Mash2 128..180 CDD:381586 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..248
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.