DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and Lyl1

DIOPT Version :10

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_032561.2 Gene:Lyl1 / 17095 MGIID:96891 Length:278 Species:Mus musculus


Alignment Length:97 Identity:35/97 - (36%)
Similarity:48/97 - (49%) Gaps:9/97 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RKSSPEQTNLSPTVQKR---RRQAANARERKRMNGLNAAFERLREVVPAPSIDQKLSKFETLQMA 148
            |:.|..:.:|:...|.:   ||...|:|||.|...:|.||..||:::|....|:||||.|.|::|
Mouse   130 RRPSHSELDLADGHQPQKVARRVFTNSRERWRQQHVNGAFAELRKLLPTHPPDRKLSKNEVLRLA 194

  Fly   149 QSYILALCDLLNNGDVEVDAAAYTIFGDSDSG 180
            ..||..|..||.      |..|....|.|..|
Mouse   195 MKYIGFLVRLLR------DQTAVLTSGPSAPG 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 bHLH_TS_ATOH1_like 104..159 CDD:381436 24/54 (44%)
Lyl1NP_032561.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
bHLH_TS_LYL1 145..209 CDD:381548 27/69 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..278 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.