DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and Neurod4

DIOPT Version :9

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001316418.1 Gene:Neurod4 / 11923 MGIID:108055 Length:330 Species:Mus musculus


Alignment Length:112 Identity:41/112 - (36%)
Similarity:62/112 - (55%) Gaps:7/112 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GTQTELGPIMEAQGQHTQPQTKRRSNSFTGSDGRKSSPEQTNLSPTVQKR---RRQAANARERKR 115
            |:...||.:.|......:.:.:...    |...::..|::..::....:|   ||..||||||.|
Mouse    39 GSYGMLGTLTEEHDSIEEDEEEEED----GDKPKRRGPKKKKMTKARLERFRARRVKANARERTR 99

  Fly   116 MNGLNAAFERLREVVPAPSIDQKLSKFETLQMAQSYILALCDLLNNG 162
            |:|||.|.:.||.|:|..|..|||||.|||::|::||.||.::|..|
Mouse   100 MHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 HLH 104..155 CDD:278439 30/50 (60%)
Neurod4NP_001316418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..80 6/44 (14%)
HLH 88..144 CDD:238036 32/55 (58%)
Neuro_bHLH 146..263 CDD:289310 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.