DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and Atoh1

DIOPT Version :9

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_031526.1 Gene:Atoh1 / 11921 MGIID:104654 Length:351 Species:Mus musculus


Alignment Length:167 Identity:65/167 - (38%)
Similarity:82/167 - (49%) Gaps:52/167 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AFLSPEWQFLDAAGGTQ-----TELG------PIMEAQGQHTQPQTKRRSNSFTGSDGRKSSP-- 91
            |:|:|..|.|..|...|     .|||      |..||.   :|.:..|||    |..|...||  
Mouse    61 AWLTPTLQGLCTARAAQYLLHSPELGASEAAAPRDEAD---SQGELVRRS----GCGGLSKSPGP 118

  Fly    92 -----------------------------EQTNLSPTVQKRRRQAANARERKRMNGLNAAFERLR 127
                                         :|.|   .|||:||.|||||||:||:|||.||::||
Mouse   119 VKVREQLCKLKGGVVVDELGCSRQRAPSSKQVN---GVQKQRRLAANARERRRMHGLNHAFDQLR 180

  Fly   128 EVVPAPSIDQKLSKFETLQMAQSYILALCDLLNNGDV 164
            .|:|:.:.|:||||:|||||||.||.||.:||...:|
Mouse   181 NVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPNV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 HLH 104..155 CDD:278439 34/50 (68%)
Atoh1NP_031526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..116 9/33 (27%)
HLH 155..213 CDD:238036 38/57 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..278
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 1 1.000 - - X4691
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.900

Return to query results.
Submit another query.