DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cato and neurod6b

DIOPT Version :9

Sequence 1:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001296772.1 Gene:neurod6b / 114415 ZFINID:ZDB-GENE-010608-2 Length:332 Species:Danio rerio


Alignment Length:103 Identity:43/103 - (41%)
Similarity:58/103 - (56%) Gaps:2/103 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IMEAQGQHTQPQTKRRSNSFTGSDGRKSSPEQTNLSPTVQ--KRRRQAANARERKRMNGLNAAFE 124
            :.||:..:|..:.:...........:|..|.:........  |.|||.||||||.||:|||.|.|
Zfish    50 LKEAEDDNTDREEEEEREEDENGLPKKKGPRKKKSEGRGDRVKMRRQEANARERSRMHGLNDALE 114

  Fly   125 RLREVVPAPSIDQKLSKFETLQMAQSYILALCDLLNNG 162
            .||:|||..|..|||||.|||::|::||.||.:.|:.|
Zfish   115 SLRKVVPCYSKTQKLSKIETLRLAKNYIWALSETLSAG 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
catoNP_477344.1 HLH 104..155 CDD:278439 33/50 (66%)
neurod6bNP_001296772.1 HLH 92..150 CDD:238036 36/57 (63%)
Neuro_bHLH 152..271 CDD:289310 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.