DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33017 and LOC5667619

DIOPT Version :10

Sequence 1:NP_788375.1 Gene:CG33017 / 36811 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster
Sequence 2:XP_001689309.3 Gene:LOC5667619 / 5667619 VectorBaseID:AGAMI1_006212 Length:264 Species:Anopheles gambiae


Alignment Length:176 Identity:41/176 - (23%)
Similarity:64/176 - (36%) Gaps:40/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLIRLYRSNECLWNPKSPGFHSGSAKDDAWRQITRR---MNCGLTPDQVELQVLGLRHYYSKELA 81
            :.|.||:|..|||:..|..:...:.|..|:.|:.::   ::...|...|..::..||..|.:||.
Mosquito    12 EFILLYKSFPCLWDITSKAYIDRAEKQKAYDQLVQKYKEIDKNATRHTVTKKINTLRTCYRRELG 76

  Fly    82 AIRNSQIEGYS----YSPRYSYFEDLHFL--GNLEEEA----NCPIK------------------ 118
            .|..|...|.|    |.|...||:...||  |..::|.    .|...                  
Mosquito    77 KISKSIRSGASEENVYQPTLWYFDLFTFLDEGKGQDEELPYDGCDTSAAAHDSAVEEIVEHIEIE 141

  Fly   119 ----EGH-----FPPNFSEDTFISPLAFLSPSCSETRCGYTFYKMI 155
                |.|     :.....|:..:||.:..|.:.:|...|...|..|
Mosquito   142 YIDDETHQDSNDYDSTGDEERLLSPCSMGSSNVAEPSSGKRKYSSI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33017NP_788375.1 MADF_DNA_bdg 21..106 CDD:463144 26/91 (29%)
PTZ00108 <580..830 CDD:240271
LOC5667619XP_001689309.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.