DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33017 and CG6175

DIOPT Version :9

Sequence 1:NP_001286483.1 Gene:CG33017 / 36811 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster
Sequence 2:NP_001261708.1 Gene:CG6175 / 39271 FlyBaseID:FBgn0036152 Length:569 Species:Drosophila melanogaster


Alignment Length:531 Identity:81/531 - (15%)
Similarity:165/531 - (31%) Gaps:167/531 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YRSNECLWNPKSPGFHSGSAKDDAWRQITRRMNCGLTPDQVELQVLGLRHYYSKELAAIRNSQIE 89
            ||....||:|.:.|:|....|.:|.:.::::.  |.....:..::..||..:.:|...:.:.:..
  Fly    68 YRRQRVLWDPNTKGYHIKQTKYEALKLLSQKY--GTEIRSIRSKIKSLRSSFHREHGKVLSGRNR 130

  Fly    90 GYSYSPRYSYFEDLHFLGNLEEEANCPIKEGHFPPNFSEDTFISPLAFL-SPSCSETRCGYTFYK 153
            |..|.|.:..:|.:.|:  |:.|.:....:.......:|......||.: |....:.:......:
  Fly   131 GVIYQPMWFAYEAIRFI--LDGERDQDRDQDQDQDAETETEVDEKLALMHSLDLEQLKADKLVDR 193

  Fly   154 -MILEPEPPNEEFLGVHHERSTS-------------------GNDRWYPTA-------------- 184
             :||:.|...::     |:..|:                   ..:|...||              
  Fly   194 DIILQVEQQQQQ-----HDELTARIAATVAAVAAAAAAANARDRERDVDTAGDMDTTRELELEEA 253

  Fly   185 -----------------------YCVRCKPEEDEDPCEACELRGQSSRPQ-FGSKSSLEGGESGS 225
                                   :|.|...:.|.:  ..|.:..:..:.: ...:|.|...:..:
  Fly   254 AVGGGLIESSSAAVRLDWRVCIDFCTRSSSDLDGE--NYCNISAEDVKTEIIEHESELGMLDRRT 316

  Fly   226 TNPRMSNRYQEQD--QSNKFQKSDSKQYRTGKPCSCPTK---------------DNPEKRSSQTQ 273
            :.|...|.|:..|  .:::.:|:...::..|.....|.|               ...:::..|.|
  Fly   317 STPSPINYYKPTDLTYNHRKRKAMGVEHVVGALTLTPIKVVGGAVGAGTVGSAGHQQQQQHQQQQ 381

  Fly   274 QNDVYVGADNWDGYESVGNGIRSDRWPGPRLCSQKRGEWKPRFRKVIGEDNQKSCCDSWKRNNNA 338
            .|...:.......:.|..:|:......|.....|::.:.:|..::   :..|::.          
  Fly   382 MNHSQLAFQALQQHFSHNHGLSLSHCNGQPQQQQQQHQHQPHHQQ---QQQQQAL---------- 433

  Fly   339 VCGRLLDQLAKQQNQPGSYSDDGDSVRNQSCGCTKNRRQSGEDQLNVMLLQKKYRDRTLSNNANN 403
                   .|..||.|..|.:                            :.||:.|||.||.:..|
  Fly   434 -------HLQHQQQQQHSSN----------------------------MAQKRDRDRDLSTSNGN 463

  Fly   404 PTTDRHSNT--QPISDQTYYNTSHPVPNCCYCTYNQVNQDVQRCNIHGCQCIYCNQTVPP---AH 463
            ..:...:||  :||:..:         ||...:.|.                  :...||   ..
  Fly   464 GNSSNTNNTSLEPIATSS---------NCSSSSSNN------------------SAATPPKPLLG 501

  Fly   464 GNYYQPHHVDQ 474
            |.....:|||:
  Fly   502 GGGLSANHVDE 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33017NP_001286483.1 MADF_DNA_bdg 21..106 CDD:287510 17/80 (21%)
CG6175NP_001261708.1 MADF_DNA_bdg 64..147 CDD:287510 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.