DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33017 and CG8281

DIOPT Version :9

Sequence 1:NP_001286483.1 Gene:CG33017 / 36811 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster
Sequence 2:NP_648161.1 Gene:CG8281 / 38880 FlyBaseID:FBgn0035824 Length:348 Species:Drosophila melanogaster


Alignment Length:176 Identity:41/176 - (23%)
Similarity:64/176 - (36%) Gaps:57/176 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IRLYRSNECLWNPKSPGFHSGSAKDDAWRQ---ITRRMNCGLTPDQVELQVLGLRHYYSKELAAI 83
            |:.||....||:.....:.:...:.:|:.:   |...:....|.:.|:.::..||..|.|||..:
  Fly    27 IQTYRDLPVLWDTSLRDYTNREKRAEAYLRLVPIYHYLKRDATVEDVKKKINTLRTNYRKELKVV 91

  Fly    84 RNSQIEGYSYSPRYSYFEDLHFLGNLE------------------EEANCPI----KEG---HFP 123
            .::...|..:|||...|::|.||.|.|                  |.:|||.    .:|   |:|
  Fly    92 ESALRSGSLHSPRCWTFQELDFLRNSEKFLAVNPAFKNEPNFAFGESSNCPSAFLESQGAALHYP 156

  Fly   124 --------PNFSEDTFISPLAFLSPSCSETRCGYTFYKMILEPEPP 161
                    ||.||                     .|:|....|.||
  Fly   157 APRAGGQTPNISE---------------------MFHKSFGAPPPP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33017NP_001286483.1 MADF_DNA_bdg 21..106 CDD:287510 21/86 (24%)
CG8281NP_648161.1 MADF_DNA_bdg 26..114 CDD:287510 21/86 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.