DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33017 and CG3386

DIOPT Version :9

Sequence 1:NP_001286483.1 Gene:CG33017 / 36811 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster
Sequence 2:NP_001261216.1 Gene:CG3386 / 38081 FlyBaseID:FBgn0035152 Length:288 Species:Drosophila melanogaster


Alignment Length:196 Identity:38/196 - (19%)
Similarity:72/196 - (36%) Gaps:59/196 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1168 ETTESRRNESRNSDRAPETRPSNRDIKEIQNPNNAYDIDIKNKTHDVGEYSKNDNRNANHNSIVS 1232
            ||.:.|..:.|...:..:.|....|...::||    |::    |..|.::               
  Fly   115 ETFQHRTRKGRGGRQKQDFRREKDDKYPLKNP----DLN----TESVCDW--------------- 156

  Fly  1233 PVSDDDCICDVESDPKDPKSTVPEKRNQAGSICINLSTSVEDKEHKMQ-----SFGKAKKTAEPT 1292
            |:.||:.. :.:|:|..|:|       :.||:.......:|.:|.:.:     |.|.:.:|.|||
  Fly   157 PIKDDNAF-NYQSEPTAPQS-------EEGSLLSPKLEIIEPEEGQCEVKEENSLGNSLETKEPT 213

  Fly  1293 VMVPKSLDASNRLREQKEGKTKLVTTSENQSSSAKKNIRAKTGISPR---VQSRSTSPVRQTGAT 1354
                                :.:.|..||:..:|...:...:.:..|   :|....||.::..|.
  Fly   214 --------------------SSIQTDPENERGTAPMQLSESSEVLARSWAIQYEEMSPTQRILAR 258

  Fly  1355 K 1355
            |
  Fly   259 K 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33017NP_001286483.1 MADF_DNA_bdg 21..106 CDD:287510
CG3386NP_001261216.1 MADF_DNA_bdg 20..111 CDD:287510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.