DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33017 and CG10904

DIOPT Version :9

Sequence 1:NP_001286483.1 Gene:CG33017 / 36811 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster
Sequence 2:NP_001286800.1 Gene:CG10904 / 37817 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster


Alignment Length:287 Identity:61/287 - (21%)
Similarity:98/287 - (34%) Gaps:83/287 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KKTQKLIRLYRSNECLWNPKSPGFHSGSAKDDAWRQITRRMNCGLTPDQVELQVLGLRHYYSKEL 80
            :|..|||.||||::||||..|..:.:...:..|...|...:.  :|......:|..||:.::.||
  Fly    27 EKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLE--ITKHDYGKKVHNLRNQFNAEL 89

  Fly    81 AAI-RNSQIEGYSYSPRYSYFEDLHFLGNLEEEANCPIKEGHFPPNFSEDTFISPLAFLSPSCSE 144
            ..: |..:..|                |:.:.|..|  :..||          ..|.||      
  Fly    90 KKLERRLEESG----------------GDRDSEKAC--RWEHF----------KTLMFL------ 120

  Fly   145 TRCGYTFYKMILEPEPPNEEFLGVHHERSTSGNDRWYPTAYCVRCKPEEDEDPCEACELRGQSSR 209
                    :.::||.|..::  |...::..|..|..||           |:|    .|.:.|||.
  Fly   121 --------RSVIEPRPGYQQ--GAPGKKLVSKLDMCYP-----------DQD----VEKQSQSSI 160

  Fly   210 PQFGSKSSLEGGESGSTNPRMSNRY----QEQDQSNKFQKSDSKQYRTGKPCSCPTKDNPEKRSS 270
            ....| ..:|........|::|...    .|...|:||...:       :....|...:|.....
  Fly   161 ESLES-MIIENDAEICQPPKVSEPIPPMPPEPAPSSKFVDPN-------RTVEAPAAPSPFHLPL 217

  Fly   271 QTQQNDVYVGADNWDGY-ESVGNGIRS 296
            .        |.|.||.: |.:.:..|:
  Fly   218 S--------GRDQWDAFGELIASEFRN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33017NP_001286483.1 MADF_DNA_bdg 21..106 CDD:287510 21/85 (25%)
CG10904NP_001286800.1 MADF 31..125 CDD:214738 30/137 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.