DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33017 and CG5953

DIOPT Version :10

Sequence 1:NP_788375.1 Gene:CG33017 / 36811 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster
Sequence 2:NP_609796.1 Gene:CG5953 / 34985 FlyBaseID:FBgn0032587 Length:701 Species:Drosophila melanogaster


Alignment Length:117 Identity:28/117 - (23%)
Similarity:47/117 - (40%) Gaps:15/117 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLIRLYRSNECLWNPKSPGFHSGSAKDDAWRQITRRMNCGLTPDQVELQVLGLRHY-------YS 77
            :||..||.:..|||...|.:.....:..||.:|..|..|.....:.::.|| |..|       :.
  Fly    85 ELIEQYRCHTELWNRADPKYKDKLCRFRAWSEIAERFGCSKAEVERKMNVL-LTQYRREKHKMFV 148

  Fly    78 KELAAIRNSQIEGYSYSPRYSYFE----DLHFLGNLEEEANCPIKEGHFPPN 125
            |....|:.:..:.|::. |:.:.|    .|...|::....|.  ..|:..||
  Fly   149 KIYQGIQPNPSKWYAFK-RFDFMEAGGGSLSGGGSVGSGVNA--ASGNLVPN 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33017NP_788375.1 MADF_DNA_bdg 21..106 CDD:463144 23/95 (24%)
PTZ00108 <580..830 CDD:240271
CG5953NP_609796.1 MADF 85..171 CDD:214738 21/87 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.