DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33017 and CG30403

DIOPT Version :9

Sequence 1:NP_001286483.1 Gene:CG33017 / 36811 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster
Sequence 2:NP_726108.3 Gene:CG30403 / 246595 FlyBaseID:FBgn0050403 Length:302 Species:Drosophila melanogaster


Alignment Length:113 Identity:38/113 - (33%)
Similarity:54/113 - (47%) Gaps:19/113 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KKTQKLIRLYRSNECLWNPKSPGFHSGSAKDDAWRQITRRMNC-------GLTPDQVELQVLGLR 73
            ::|.|.:.||....|||| |.|  :...|:..|:|:|...:|.       |||...|::::..||
  Fly    19 ERTVKFVELYGREPCLWN-KRP--YLRRARSAAYRRIQSGINADIEPYESGLTIQGVKMKIKNLR 80

  Fly    74 HYYSKELAAIRNSQIEGYSYSPRYSYFEDLH-----FLGNLEEEANCP 116
            ..|.:||..||.  |.|  |.|:..:|..||     ||...|.|.:.|
  Fly    81 TGYHQELKKIRT--IPG--YQPKTPWFAPLHGFLAEFLDTNELETSIP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33017NP_001286483.1 MADF_DNA_bdg 21..106 CDD:287510 31/96 (32%)
CG30403NP_726108.3 GT1 24..103 CDD:304916 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.