DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Khc and ZC262.7

DIOPT Version :9

Sequence 1:NP_476590.1 Gene:Khc / 36810 FlyBaseID:FBgn0001308 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001293636.1 Gene:ZC262.7 / 24105263 WormBaseID:WBGene00043948 Length:171 Species:Caenorhabditis elegans


Alignment Length:126 Identity:73/126 - (57%)
Similarity:93/126 - (73%) Gaps:1/126 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   840 ESEEDGGSLAQKQKISFLENNLDQLTKVHKQLVRDNADLRCELPKLEKRLRCTMERVKALETALK 904
            |.|:.....||||:|.|||||||:||||||||||||||||.||||:|.|||...:|:|.|||||:
 Worm    15 EGEDSLSGPAQKQRIQFLENNLDKLTKVHKQLVRDNADLRVELPKMEARLRGREDRIKILETALR 79

  Fly   905 EAKEGAMRDRKRYQYEVDRIKEAVRQKHLGRRGPQAQIAKPIRSGQGAIAIRGGGAVGGPS 965
            ::|:.:..:||:||.||:||||||||::: ||....||.||||.||...:...|.:.|.|:
 Worm    80 DSKQRSQAERKKYQQEVERIKEAVRQRNM-RRMNAPQIVKPIRPGQVYTSPSAGMSQGAPN 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KhcNP_476590.1 KISc_KHC_KIF5 10..333 CDD:276820
KISc 12..340 CDD:214526
Apolipoprotein 595..744 CDD:279749
ZC262.7NP_001293636.1 Striatin <26..96 CDD:285445 46/69 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1334528at2759
OrthoFinder 1 1.000 - - FOG0000669
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.