DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Khc and ZC262.7

DIOPT Version :10

Sequence 1:NP_476590.1 Gene:Khc / 36810 FlyBaseID:FBgn0001308 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001293636.1 Gene:ZC262.7 / 24105263 WormBaseID:WBGene00043948 Length:171 Species:Caenorhabditis elegans


Alignment Length:126 Identity:73/126 - (57%)
Similarity:93/126 - (73%) Gaps:1/126 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   840 ESEEDGGSLAQKQKISFLENNLDQLTKVHKQLVRDNADLRCELPKLEKRLRCTMERVKALETALK 904
            |.|:.....||||:|.|||||||:||||||||||||||||.||||:|.|||...:|:|.|||||:
 Worm    15 EGEDSLSGPAQKQRIQFLENNLDKLTKVHKQLVRDNADLRVELPKMEARLRGREDRIKILETALR 79

  Fly   905 EAKEGAMRDRKRYQYEVDRIKEAVRQKHLGRRGPQAQIAKPIRSGQGAIAIRGGGAVGGPS 965
            ::|:.:..:||:||.||:||||||||::: ||....||.||||.||...:...|.:.|.|:
 Worm    80 DSKQRSQAERKKYQQEVERIKEAVRQRNM-RRMNAPQIVKPIRPGQVYTSPSAGMSQGAPN 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KhcNP_476590.1 KISc_KHC_KIF5 10..333 CDD:276820
Smc <341..>807 CDD:440809
Khc_CBD_cc 856..925 CDD:467880 46/68 (68%)
ZC262.7NP_001293636.1 Khc_CBD_cc 31..100 CDD:467880 46/68 (68%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.