DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fidipidine and AT4G32560

DIOPT Version :9

Sequence 1:NP_523760.1 Gene:fidipidine / 36808 FlyBaseID:FBgn0025519 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_567897.1 Gene:AT4G32560 / 829391 AraportID:AT4G32560 Length:306 Species:Arabidopsis thaliana


Alignment Length:266 Identity:74/266 - (27%)
Similarity:134/266 - (50%) Gaps:12/266 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 EQKEKTKEVEDQLNTLNTELKAHKDTQDKADPKLLEKIQSLLQQHEELKKSEAEFKESCRTDLAN 394
            ||.::..:.:|:|..|...:.  |:..|.:..:|:..::||    :|..|.|:|.:..|....:.
plant    43 EQNQRKCDAKDKLQQLRERIS--KEVVDVSVQELIPLLRSL----KEFVKEESEVRSRCNVKRSA 101

  Fly   395 LQLQIDDLESFSAQ--DAEAQAAALAG----EEQRLKELRLQLAKRNRGIVAIERKLDAIPDRTE 453
            |:..:.|||..:.:  |.|.|...|.|    ....|...:.:|....|.||:::|::|.:|.::|
plant   102 LEDAVHDLEERAGKGLDGEIQEEDLDGLLVVSLDNLTSAKKELGATLREIVSLKRQIDDVPCQSE 166

  Fly   454 LAQYQRRFHELHNEMSGKHLETKQYYTLYNTLNDKKRYMEKELALLNSICEAYNEGMMSPHGRED 518
            |.||:|||.||:..:..|..:|::.|..||.|.:.|..|.||.:|||||...:.:.:.:|.||..
plant   167 LLQYERRFSELNVCIQEKLQQTRKLYATYNALLEIKDLMLKETSLLNSIGSQFQDVIGTPAGRVK 231

  Fly   519 FIRQFESIVDGVKSAQDKVRHKYNEERMRRDELNEELQSLLELQRQYALAVKQLTRECQRCEQLQ 583
            .|...|.::.|::....|::....||:..||...|:..:....||:....::....||.:.|:|:
plant   232 LIDSMEGVMKGIQQKIGKIQLGLQEEQRLRDASKEKYIAAAAEQRKCYTVLRAYQEECTKNERLR 296

  Fly   584 LQLRSI 589
            ..:.::
plant   297 SHISAM 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fidipidineNP_523760.1 KOG2701 42..219 CDD:286803
AT4G32560NP_567897.1 SMC_prok_B <20..>306 CDD:274008 74/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I2202
eggNOG 1 0.900 - - E1_KOG2701
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10393
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091136at2759
OrthoFinder 1 1.000 - - FOG0004838
OrthoInspector 1 1.000 - - oto3467
orthoMCL 1 0.900 - - OOG6_104885
Panther 1 1.100 - - LDO PTHR16441
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.